TorqFix

Removing and installing radiator fan: VW Phaeton (BWS, CAVD, CAXA, CAYC, …)

Step-by-step removing and installing radiator fan for the VW Phaeton: 14 steps. What to remove, in what order, and what to check after.

Workshop procedure for VW — the exact step sequence and torque figures, straight from real workshop data.

14 steps 40 engine codes engine codes merged from 25 documented variants

🧭 Before you start

Fits: VW Phaeton (3D)

🔧 Engine codes this applies to

BWSCAVDCAXACAYCCBFACBTACBUACBZBCCCACCTACCZACDLJCFFACFFBCFGBCFGCCFHCCHNACJZDCLLACMVACNLACNNACNWACPFACPKACPLACPPACPRACRJACTHDCTKACULCCUSACUSBCUTACUUACUUBCVCACWVA

📐 5 workshop diagrams for BWS

Real factory drawings for this job — timing marks, bolt locations and routing. Locked in the free view.

Removing and installing radiator fan — BWS · diagram 1
Removing and installing radiator fan — BWS · diagram 2
Removing and installing radiator fan — BWS · diagram 3
Removing and installing radiator fan — BWS · diagram 4
Removing and installing radiator fan — BWS · diagram 5
🔒 5 workshop diagrams for this job Ask about your VW BWS — free or sign up free to see the drawings

📋 Procedure

  1. Remove noise insulation General body repairs, exterior66Noise insulation; Assembly overview - noise insulation.
  2. Remove front coolant pipe (1) from fan mounting by unscrewing bolts (arrows).
  3. Remove front bumper General body repairs, exterior63Front bumper; Removing and installing front bumper
  4. Detach left headlight Electrical system94Headlight.
  5. Bring lock carrier into service position General body repairs, exterior50Lock carrier - bringing lock carrier into service position and moving it back.
BWS? Steps differ between engine variants — check this job against your exact car before you commit to it. Check my car — free →
  1. Remove fan support with fans .
  2. Unscrew radiator fan V7(1) and radiator fan control unit J293(2).
  3. Uncover cables.
  4. Remove radiator fan V7.
  5. Unscrew radiator fan 2V177(1) and radiator fan control unit 2J671(2).
  6. Uncover cables.
  7. Remove radiator fan 2V177.
  8. Electrical connections and routing .
  9. Check headlight adjustment and correct if necessary 17.1
Workshop diagrams

Ask TorqFix about your VW BWS — it answers with the exact sequence for that engine and the workshop drawing for each step. First question is free after a 20-second sign-up, no card.

Ask about your VW BWS — free → or sign up free to see the drawings

Other VW procedures

Who makes these pages, and how

TorqFix was built by a mechanic — after a 2,700 km drive with five roadside repairs that no diagnostic tool could explain.

The figures on this page come from manufacturer workshop documentation and are shown as they are. The page is assembled automatically from that data — it is not written by an AI. The AI works in the chat, where it answers for your specific car. It writes nothing here.

Variants of the same model differ. Cross-check torque against the factory manual for your engine before final tightening.

Seen a figure that does not match your manual? Write to us — we correct it and note when. support@torqfix.com

The story behind TorqFix →

Workshop data on this page last updated 20 Sep 2026.