TorqFix

Removing and installing Hall sender: VW 2.0 TDI (CBAA, CBAB, CBAC, CBBA, …)

Step-by-step removing and installing Hall sender for the VW 2.0 TDI: 13 steps. What to remove, in what order, and what to check after.

Workshop procedure for VW — the exact step sequence and torque figures, straight from real workshop data.

13 steps 38 engine codes engine codes merged from 12 documented variants

🧭 Before you start

Fits: platform codes 602, 604, 603

Don't miss

  • 2 versions of tensioning roller are fitted. They are not interchangeable. When making adjustments, first check which tensioning roller is fitted .

🔧 Engine codes this applies to

CBAACBABCBACCBBACBBBCBDACBDBCBDCCFFACFFBCFFDCFGBCFGCCFHBCFHCCFHFCFJACFJBCGNACHNACJAACJZDCLCACLJACLLACLNACMVACPFACPKACPLACPPACPRACULCCWVACWVBCWXACWXBCYVD

📐 48 workshop diagrams for CBAA

Real factory drawings for this job — timing marks, bolt locations and routing. Locked in the free view.

Removing and installing Hall sender — CBAA · diagram 1
Removing and installing Hall sender — CBAA · diagram 2
Removing and installing Hall sender — CBAA · diagram 3
Removing and installing Hall sender — CBAA · diagram 4
Removing and installing Hall sender — CBAA · diagram 5
Removing and installing Hall sender — CBAA · diagram 6
Removing and installing Hall sender — CBAA · diagram 7
Removing and installing Hall sender — CBAA · diagram 8
+ 40 more diagrams
🔒 48 workshop diagrams for this job Ask about your VW CBAA — free or sign up free to see the drawings

📋 Procedure

  1. Remove engine cover panel .
  2. Remove fuel filter with bracket Fuel supply20.
  3. Remove poly V-belt .
  4. Remove front right wheel housing liner: General body repairs, exterior66Wheel housing liner; Removing and installing wheel housing liner.
  5. Remove vibration damper .
CBAA? Steps differ between engine variants — check this job against your exact car before you commit to it. Check my car — free →
  1. Remove engine support . [Note: 2 versions of tensioning roller are fitted. They are not interchangeable. When making adjustments, first check which tensioning roller is fitted .]
  2. Disconnect connector (1) for Hall sender G40 and pull connector out of retainer.
  3. Detach plug from its retainer.
  4. Unscrew Hall sender G40(arrow).
  5. Remove webs and repair aperture cover (arrows) with a screwdriver.
  6. Remove Hall sender G40 from cylinder head and guide its plug through repair aperture in toothed belt guard.
  7. Fit toothed belt and adjust valve timing .
  8. Reinstall engine support.
Workshop diagrams

Ask TorqFix about your VW CBAA — it answers with the exact sequence for that engine and the workshop drawing for each step. First question is free after a 20-second sign-up, no card.

Ask about your VW CBAA — free → or sign up free to see the drawings

Other VW procedures

Who makes these pages, and how

TorqFix was built by a mechanic — after a 2,700 km drive with five roadside repairs that no diagnostic tool could explain.

The figures on this page come from manufacturer workshop documentation and are shown as they are. The page is assembled automatically from that data — it is not written by an AI. The AI works in the chat, where it answers for your specific car. It writes nothing here.

Variants of the same model differ. Cross-check torque against the factory manual for your engine before final tightening.

Seen a figure that does not match your manual? Write to us — we correct it and note when. support@torqfix.com

The story behind TorqFix →

Workshop data on this page last updated 20 Sep 2026.